Structure 4; room temperature crystal structure of truncated pak pilin from pseudomonas aeruginosa at 1.63a resolution
PDB DOI: 10.2210/pdb1x6p/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Pseudomonas Aeruginosa
Deposited: 2004-08-11 Deposition Author(s): Dunlop, K.V. , Hazes, B. , Irvin, R.T.
Structure 4; room temperature crystal structure of truncated pak pilin from pseudomonas aeruginosa at 1.63a resolution
Dunlop, K.V. , Hazes, B. , Irvin, R.T.
Primary Citation of Related Structures: 1X6P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fimbrial protein | A | 123 | Pseudomonas Aeruginosa | ALEGTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-08-11 Deposition Author(s): Dunlop, K.V. , Hazes, B. , Irvin, R.T.