Solution structure of the lim domain of carboxyl terminal lim domain protein 1
PDB DOI: 10.2210/pdb1x62/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-05-17 Deposition Author(s): Hayashi, F. , Nagashima, T. , Qin, X.R. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Solution structure of the lim domain of carboxyl terminal lim domain protein 1
Hayashi, F. , Nagashima, T. , Qin, X.R. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 1X62
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| C-terminal LIM domain protein 1 | A | 79 | Homo Sapiens | GSSGSSGSIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-17 Deposition Author(s): Hayashi, F. , Nagashima, T. , Qin, X.R. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.