Solution structure of the sh3 domain of human osteoclast stimulating factor 1 (ostf1)
PDB DOI: 10.2210/pdb1x2k/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-04-25 Deposition Author(s): Inoue, M. , Kamatari, Y.O. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S.
Solution structure of the sh3 domain of human osteoclast stimulating factor 1 (ostf1)
Inoue, M. , Kamatari, Y.O. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 1X2K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Osteoclast stimulating factor 1 | A | 68 | Homo Sapiens | GSSGSSGKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-04-25 Deposition Author(s): Inoue, M. , Kamatari, Y.O. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S.