Nmr structure of growth factor receptor binding protein sh2 domain complexed with the inhibitor
PDB DOI: 10.2210/pdb1x0n/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-03-24 Deposition Author(s): Burke, T.R. , Inagaki, F. , Ogura, K. , Shiga, T. , Yokochi, M. , Yuzawa, S.
Nmr structure of growth factor receptor binding protein sh2 domain complexed with the inhibitor
Burke, T.R. , Inagaki, F. , Ogura, K. , Shiga, T. , Yokochi, M. , Yuzawa, S.
Primary Citation of Related Structures: 1X0N
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Growth factor receptor-bound protein 2 | A | 104 | Homo Sapiens | GSHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT |
Method: SOLUTION NMR
Deposited Date: 2005-03-24 Deposition Author(s): Burke, T.R. , Inagaki, F. , Ogura, K. , Shiga, T. , Yokochi, M. , Yuzawa, S.