1WXB
Solution structure of the sh3 domain from human epidermal growth factor receptor pathway substrate 8-like protein
PDB DOI: 10.2210/pdb1wxb/pdb
Classification: Structural genomics, unknown function Organism(s): Homo Sapiens
Deposited: 2005-01-20 Deposition Author(s): Chikayama, E. , Inoue, M. , Kigawa, T. , Koshiba, S. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the sh3 domain from human epidermal growth factor receptor pathway substrate 8-like protein
Chikayama, E. , Inoue, M. , Kigawa, T. , Koshiba, S. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 1WXB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Epidermal growth factor receptor pathway substrate 8-like protein | A | 68 | Homo Sapiens | GSSGSSGKYVKILYDFTARNANELSVLKDEVLEVLEDGRQWWKLRSRSGQAGYVPCNILGEASGPSSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-01-20 Deposition Author(s): Chikayama, E. , Inoue, M. , Kigawa, T. , Koshiba, S. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.