Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3 in complex with biotin
PDB DOI: 10.2210/pdb1wpy/pdb
Classification: LIGASE Organism(s): Pyrococcus Horikoshii
Deposited: 2004-09-17 Deposition Author(s): Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)
Crystal structure of biotin-(acetyl-coa-carboxylase) ligase from pyrococcus horikoshii ot3 in complex with biotin
Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)
Primary Citation of Related Structures: 1WPY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| biotin--[acetyl-CoA-carboxylase] ligase | A | 235 | Pyrococcus Horikoshii | MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL |
| biotin--[acetyl-CoA-carboxylase] ligase | B | 235 | Pyrococcus Horikoshii | MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-09-17 Deposition Author(s): Bagautdinov, B. , Kunishima, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi)