Solution structure of the second ww domain of wwox
PDB DOI: 10.2210/pdb1wmv/pdb
Classification: OXIDOREDUCTASE, APOPTOSIS Organism(s): Homo Sapiens
Deposited: 2004-07-21 Deposition Author(s): Booker, G.W. , Colella, A. , Kowalski, K. , Merkel, A.L. , Richards, R.I.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the second ww domain of wwox
Booker, G.W. , Colella, A. , Kowalski, K. , Merkel, A.L. , Richards, R.I.
Primary Citation of Related Structures: 1WMV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| WW domain containing oxidoreductase | A | 54 | Homo Sapiens | GSAKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKP |
Method: SOLUTION NMR
Deposited Date: 2004-07-21 Deposition Author(s): Booker, G.W. , Colella, A. , Kowalski, K. , Merkel, A.L. , Richards, R.I.