Solution structure of the dna-binding domain of squamosa promoter binding protein-like 12 lacking the second zinc-binding site
PDB DOI: 10.2210/pdb1wj0/pdb
Classification: DNA BINDING PROTEIN Organism(s): Arabidopsis Thaliana
Deposited: 2004-05-28 Deposition Author(s): Inoue, M. , Kigawa, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yamasaki, K. , Yokoyama, S.
Solution structure of the dna-binding domain of squamosa promoter binding protein-like 12 lacking the second zinc-binding site
Inoue, M. , Kigawa, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yamasaki, K. , Yokoyama, S.
Primary Citation of Related Structures: 1WJ0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
squamosa promoter-binding protein-like 12 | A | 60 | Arabidopsis Thaliana | GSAICCQVDNCGADLSKVKDYHRRHKVCEIHSKATTALVGGIMQRFCQQCSRFHVLEEFD |
Method: SOLUTION NMR
Deposited Date: 2004-05-28 Deposition Author(s): Inoue, M. , Kigawa, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yamasaki, K. , Yokoyama, S.