Solution structure of phd domain in inhibitor of growth family, member 1-like
PDB DOI: 10.2210/pdb1wes/pdb
Classification: DNA BINDING PROTEIN Organism(s): Enterobacter Aerogenes
Deposited: 2004-05-25 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Solution structure of phd domain in inhibitor of growth family, member 1-like
He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 1WES
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
inhibitor of growth family, member 1-like | A | 71 | Enterobacter Aerogenes | GSSGSSGEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2004-05-25 Deposition Author(s): He, F. , Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Yokoyama, S.