Crystal structures of the hyperthermophilic chromosomal protein sac7d in complex with dna decamers
PDB DOI: 10.2210/pdb1wd0/pdb
Classification: structural protein/DNA Organism(s): Sulfolobus Acidocaldarius , Synthetic Construct
Deposited: 2004-05-10 Deposition Author(s): Chen, C.-Y. , Chou, C.-C. , Chu, H.-M. , Ko, T.-P. , Wang, A.H.-J.
Crystal structures of the hyperthermophilic chromosomal protein sac7d in complex with dna decamers
Chen, C.-Y. , Chou, C.-C. , Chu, H.-M. , Ko, T.-P. , Wang, A.H.-J.
Primary Citation of Related Structures: 1WD0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA-binding proteins 7a/7b/7d | A | 66 | Sulfolobus Acidocaldarius , Synthetic Construct | MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-05-10 Deposition Author(s): Chen, C.-Y. , Chou, C.-C. , Chu, H.-M. , Ko, T.-P. , Wang, A.H.-J.