Sh3 domain of human lyn tyrosine kinase in complex with a herpesviral ligand
PDB DOI: 10.2210/pdb1wa7/pdb
Classification: SH3 DOMAIN Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodotorula Dairenensis
Deposited: 2004-10-25 Deposition Author(s): Bauer, F. , Hoffmann, S. , Roesch, P. , Schweimer, K. , Sticht, H.
Method: SOLUTION NMR Resolution: N.A.
Sh3 domain of human lyn tyrosine kinase in complex with a herpesviral ligand
Bauer, F. , Hoffmann, S. , Roesch, P. , Schweimer, K. , Sticht, H.
Primary Citation of Related Structures: 1WA7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
TYROSINE-PROTEIN KINASE LYN | A | 65 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodotorula Dairenensis | GSPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNT |
HYPOTHETICAL 28.7 KDA PROTEIN IN DHFR 3'REGION (ORF1) | B | 22 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Rhodotorula Dairenensis | WDPGMPTPPLPPRPANLGERQA |
Method: SOLUTION NMR
Deposited Date: 2004-10-25 Deposition Author(s): Bauer, F. , Hoffmann, S. , Roesch, P. , Schweimer, K. , Sticht, H.