Crystal structure of the proximal bah domain of polybromo
PDB DOI: 10.2210/pdb1w4s/pdb
Classification: NUCLEAR PROTEIN Organism(s): Gallus Gallus
Deposited: 2004-07-28 Deposition Author(s): Oliver, A.W. , Pearl, L.H. , Roe, S.M.
Crystal structure of the proximal bah domain of polybromo
Oliver, A.W. , Pearl, L.H. , Roe, S.M.
Primary Citation of Related Structures: 1W4S
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| POLYBROMO 1 PROTEIN | A | 174 | Gallus Gallus | HMSSGSAGLSSLHRTYSQDCSFKNSMYHVGDYVYVEPAEANLQPHIVCIERLWEDSAGEKWLYGCWFYRPNETFHLATRKFLEKEVFKSDYYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVYVCESRYSAKTKSFKKIKLWTMPVSSVRFVPRDVPLPVVRVASVFANTD |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-07-28 Deposition Author(s): Oliver, A.W. , Pearl, L.H. , Roe, S.M.