Crystal structure of arginine biosynthesis bifunctional protein argj (10175521) from bacillus halodurans at 2.00 a resolution
PDB DOI: 10.2210/pdb1vra/pdb
Classification: TRANSFERASE Organism(s): Bacillus Halodurans
Deposited: 2005-02-17 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of arginine biosynthesis bifunctional protein argj (10175521) from bacillus halodurans at 2.00 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 1VRA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Arginine biosynthesis bifunctional protein argJ | A | 208 | Bacillus Halodurans | MGSDKIHHHHHHMNVINETANVLKLETGSVTSAKGFSAVGIHTGVKRKRKDLGAIVCEVPASSAAVYTLNKVQAAPLKVTQESIAVEGKLQAMIVNSGIANACTGKRGLDDAYTMRAVGAETFHIPEHYVAVTSTGVIGEFLPMDVITNGIRQLKPEATIEGAHAFNEAILTTDTVEKHTCYQTIVNGKTVTVGGVAKGSGMIHPNMA |
| Arginine biosynthesis bifunctional protein argJ | B | 215 | Bacillus Halodurans | TMLSFVTTDANIDHGHLQGALSAITNETFNRITVDGDTSTNDMVVVMASGLAENETLTPEHPDWANFYKALQLACEDLAKQIARDGEGATKLIEVEVTGAANDQEAGMVAKQIVGSDLVKTAIYGADANWGRIICAIGYSGCEVNQETIDIAIGPIVTLKQSEPTGFSEEEATAYLKEADPVKISVNLHIGNGTGKAWGCDLTYDYVRINAGYRT |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-02-17 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)