Proton nuclear magnetic resonance and distance geometry(slash)simulated annealing studies on the variant-1 neurotoxin from the new world scorpion centruroides sculpturatus ewing
PDB DOI: 10.2210/pdb1vna/pdb
Classification: NEUROTOXIN Organism(s): Centruroides Sculpturatus
Deposited: 1993-10-26 Deposition Author(s): Krishna, N.R. , Lee, W.
Proton nuclear magnetic resonance and distance geometry(slash)simulated annealing studies on the variant-1 neurotoxin from the new world scorpion centruroides sculpturatus ewing
Primary Citation of Related Structures: 1VNA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| NEUROTOXIN | A | 65 | Centruroides Sculpturatus | KEGYLVKKSDGCKYDCFWLGKNEHCNTECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSC |
Method: SOLUTION NMR
Deposited Date: 1993-10-26 Deposition Author(s): Krishna, N.R. , Lee, W.