Solution structure of the dna complex of human trf2
PDB DOI: 10.2210/pdb1vfc/pdb
Classification: STRUCTURAL PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2004-04-12 Deposition Author(s): Hanaoka, S. , Nishimura, Y.
Solution structure of the dna complex of human trf2
Primary Citation of Related Structures: 1VFC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Telomeric repeat binding factor 2 | A | 63 | Homo Sapiens , Synthetic Construct | EDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN |
Method: SOLUTION NMR
Deposited Date: 2004-04-12 Deposition Author(s): Hanaoka, S. , Nishimura, Y.