Solution structure of the zinc finger domain of tfiie alpha
PDB DOI: 10.2210/pdb1vd4/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2004-03-18 Deposition Author(s): Arai, Y. , Hanaoka, F. , Nagadoi, A. , Nishimura, Y. , Ohkuma, Y. , Okamura, H. , Okuda, M. , Satoh, M. , Tanaka, A.
Solution structure of the zinc finger domain of tfiie alpha
Arai, Y. , Hanaoka, F. , Nagadoi, A. , Nishimura, Y. , Ohkuma, Y. , Okamura, H. , Okuda, M. , Satoh, M. , Tanaka, A.
Primary Citation of Related Structures: 1VD4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription initiation factor IIE, alpha subunit | A | 62 | Homo Sapiens | RIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDAR |
Method: SOLUTION NMR
Deposited Date: 2004-03-18 Deposition Author(s): Arai, Y. , Hanaoka, F. , Nagadoi, A. , Nishimura, Y. , Ohkuma, Y. , Okamura, H. , Okuda, M. , Satoh, M. , Tanaka, A.