Solution structure of insectidal toxin delta-paluit2-nh2
PDB DOI: 10.2210/pdb1v91/pdb
Classification: TOXIN Organism(s): Paracoelotes Luctuosus
Deposited: 2004-01-19 Deposition Author(s): Bosmans, F. , Chagot, B. , Corzo, G. , Darbon, H. , Ferrat, G. , Nakajima, T. , Pimentel, C. , Tytgat, J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of insectidal toxin delta-paluit2-nh2
Bosmans, F. , Chagot, B. , Corzo, G. , Darbon, H. , Ferrat, G. , Nakajima, T. , Pimentel, C. , Tytgat, J.
Primary Citation of Related Structures: 1V91
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Delta-palutoxin IT2 | A | 38 | Paracoelotes Luctuosus | ACVGDGQRCASWSGPYCCDGYYCSCRSMPYCRCRNNSX |
Method: SOLUTION NMR
Deposited Date: 2004-01-19 Deposition Author(s): Bosmans, F. , Chagot, B. , Corzo, G. , Darbon, H. , Ferrat, G. , Nakajima, T. , Pimentel, C. , Tytgat, J.