Crystal structure of stam2 sh3 domain in complex with a ubpy-derived peptide
PDB DOI: 10.2210/pdb1uj0/pdb
Classification: SIGNALING PROTEIN/SIGNALING PROTEIN Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-07-24 Deposition Author(s): Ganbe, T. , Kaneko, T. , Kitamura, N. , Kumasaka, T. , Miyazawa, K. , Sato, T. , Tanaka, N.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Crystal structure of stam2 sh3 domain in complex with a ubpy-derived peptide
Ganbe, T. , Kaneko, T. , Kitamura, N. , Kumasaka, T. , Miyazawa, K. , Sato, T. , Tanaka, N.
Primary Citation of Related Structures: 1UJ0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
signal transducing adaptor molecule (SH3 domain and ITAM motif) 2 | A | 62 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AGHMARRVRALYDFEAVEDNELTFKHGELITVLDDSDANWWQGENHRGTGLFPSNFVTTDLS |
deubiquitinating enzyme UBPY | B | 11 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TPMVNRENKPP |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-07-24 Deposition Author(s): Ganbe, T. , Kaneko, T. , Kitamura, N. , Kumasaka, T. , Miyazawa, K. , Sato, T. , Tanaka, N.