Solution structure of the first pdz domain of human kiaa1526 protein
PDB DOI: 10.2210/pdb1uez/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2003-05-22 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Solution structure of the first pdz domain of human kiaa1526 protein
Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.
Primary Citation of Related Structures: 1UEZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| KIAA1526 Protein | A | 101 | Homo Sapiens | GSSGSSGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARVTHAEAVKALKGSKKLVLSVYSAGRISGPSSG |
Method: SOLUTION NMR
Deposited Date: 2003-05-22 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S.