Solution structure of yeast cox17 with copper bound
PDB DOI: 10.2210/pdb1u96/pdb
Classification: CHAPERONE Organism(s): Saccharomyces Cerevisiae
Deposited: 2004-08-09 Deposition Author(s): Abajian, C. , Ramirez, B.E. , Rosenzweig, A.C. , Yatsunyk, L.A.
Solution structure of yeast cox17 with copper bound
Abajian, C. , Ramirez, B.E. , Rosenzweig, A.C. , Yatsunyk, L.A.
Primary Citation of Related Structures: 1U96
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cytochrome c oxidase copper chaperone | A | 69 | Saccharomyces Cerevisiae | MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN |
Method: SOLUTION NMR
Deposited Date: 2004-08-09 Deposition Author(s): Abajian, C. , Ramirez, B.E. , Rosenzweig, A.C. , Yatsunyk, L.A.