Arg326-trp mutant of the third zinc finger of bklf
PDB DOI: 10.2210/pdb1u85/pdb
Classification: DNA BINDING PROTEIN Organism(s): Mus Musculus
Deposited: 2004-08-05 Deposition Author(s): Cram, E.D. , Mackay, J.P. , Matthews, J.M.
Method: SOLUTION NMR Resolution: N.A.
Arg326-trp mutant of the third zinc finger of bklf
Cram, E.D. , Mackay, J.P. , Matthews, J.M.
Primary Citation of Related Structures: 1U85
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Kruppel-like factor 3 | A | 33 | Mus Musculus | GSTGIKPFQCPDCDWSFSRSDHLALHRKRHMLV |
Method: SOLUTION NMR
Deposited Date: 2004-08-05 Deposition Author(s): Cram, E.D. , Mackay, J.P. , Matthews, J.M.