Structure of the bipartite dna-binding domain of tc3 transposase bound to transposon dna
PDB DOI: 10.2210/pdb1u78/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2004-08-03 Deposition Author(s): Sixma, T.K. , Van Pouderoyen, G. , Watkins, S.
Structure of the bipartite dna-binding domain of tc3 transposase bound to transposon dna
Sixma, T.K. , Van Pouderoyen, G. , Watkins, S.
Primary Citation of Related Structures: 1U78
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
transposable element tc3 transposase | A | 141 | Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MPRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGTSKRAPRRKALSVRDERNVIRAASNSCKTARDIRNELQLSASKRTILNVIKRSGVIVRQKLRPAPLLSADHKLKRLEFAKNNMGTHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-08-03 Deposition Author(s): Sixma, T.K. , Van Pouderoyen, G. , Watkins, S.