Auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains
PDB DOI: 10.2210/pdb1u39/pdb
Classification: PROTEIN TRANSPORT Organism(s): Homo Sapiens
Deposited: 2004-07-21 Deposition Author(s): Chan, L.-N. , Feng, W. , Fu, A. , He, C. , Ip, N.Y. , Long, J.-F. , Xia, J. , Zhang, M.
Auto-inhibition mechanism of x11s/mints family scaffold proteins revealed by the closed conformation of the tandem pdz domains
Chan, L.-N. , Feng, W. , Fu, A. , He, C. , Ip, N.Y. , Long, J.-F. , Xia, J. , Zhang, M.
Primary Citation of Related Structures: 1U39
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| amyloid beta A4 precursor protein-binding, family A, member 1 | A | 80 | Homo Sapiens | PPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPA |
Method: SOLUTION NMR
Deposited Date: 2004-07-21 Deposition Author(s): Chan, L.-N. , Feng, W. , Fu, A. , He, C. , Ip, N.Y. , Long, J.-F. , Xia, J. , Zhang, M.