The high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin
PDB DOI: 10.2210/pdb1trv/pdb
Classification: ELECTRON TRANSPORT Organism(s): Homo Sapiens
Deposited: 1994-05-10 Deposition Author(s): Clore, G.M. , Gronenborn, A.M. , Qin, J.
The high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin
Clore, G.M. , Gronenborn, A.M. , Qin, J.
Primary Citation of Related Structures: 1TRV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| THIOREDOXIN | A | 105 | Homo Sapiens | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV |
Method: SOLUTION NMR
Deposited Date: 1994-05-10 Deposition Author(s): Clore, G.M. , Gronenborn, A.M. , Qin, J.