Tmzip: a chimeric peptide model of the n-terminus of alpha tropomyosin, nmr, 15 structures
PDB DOI: 10.2210/pdb1tmz/pdb
Classification: TROPOMYOSIN Organism(s): Rattus Rattus, Saccharomyces Cerevisiae
Deposited: 1998-04-20 Deposition Author(s): Farid, R.S. , Greenfield, N.J. , Hitchcock-Degregori, S.E. , Montelione, G.T.
Tmzip: a chimeric peptide model of the n-terminus of alpha tropomyosin, nmr, 15 structures
Farid, R.S. , Greenfield, N.J. , Hitchcock-Degregori, S.E. , Montelione, G.T.
Primary Citation of Related Structures: 1TMZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TMZIP | A | 32 | Rattus Rattus, Saccharomyces Cerevisiae | MDAIKKKMQMLKLDNYHLENEVARLKKLVGER |
| TMZIP | B | 32 | Rattus Rattus, Saccharomyces Cerevisiae | MDAIKKKMQMLKLDNYHLENEVARLKKLVGER |
Method: SOLUTION NMR
Deposited Date: 1998-04-20 Deposition Author(s): Farid, R.S. , Greenfield, N.J. , Hitchcock-Degregori, S.E. , Montelione, G.T.