Crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64.
PDB DOI: 10.2210/pdb1tiq/pdb
Classification: STRUCTURAL GENOMICS, TRANSCRIPTION Organism(s): Bacillus Subtilis
Deposited: 2004-06-02 Deposition Author(s): Acton, T.B. , Forouhar, F. , Hunt, J.F. , Lee, I. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Shen, J. , Tong, L. , Vorobiev, S.M. , Xiao, R.
Crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64.
Acton, T.B. , Forouhar, F. , Hunt, J.F. , Lee, I. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Shen, J. , Tong, L. , Vorobiev, S.M. , Xiao, R.
Primary Citation of Related Structures: 1TIQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| Protease synthase and sporulation negative regulatory protein PAI 1 | A | 180 | Bacillus Subtilis | MSVKMKKCSREDLQTLQQLSIETFNDTFKEQNSPENMKAYLESAFNTEQLEKELSNMSSQFFFIYFDHEIAGYVKVNIDDAQSEEMGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIALERNKKNIWLGVWEKNENAIAFYKKMGFVQTGAHSFYMGDEEQTDLIMAKTLILEHHHHHH | 
| Protease synthase and sporulation negative regulatory protein PAI 1 | B | 180 | Bacillus Subtilis | MSVKMKKCSREDLQTLQQLSIETFNDTFKEQNSPENMKAYLESAFNTEQLEKELSNMSSQFFFIYFDHEIAGYVKVNIDDAQSEEMGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIALERNKKNIWLGVWEKNENAIAFYKKMGFVQTGAHSFYMGDEEQTDLIMAKTLILEHHHHHH | 
Method: X-RAY DIFFRACTION
Deposited Date: 2004-06-02 Deposition Author(s): Acton, T.B. , Forouhar, F. , Hunt, J.F. , Lee, I. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Shen, J. , Tong, L. , Vorobiev, S.M. , Xiao, R.
 
                  