0.97-a structure of the sh3 domain of bbc1
PDB DOI: 10.2210/pdb1tg0/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Saccharomyces Cerevisiae
Deposited: 2004-05-28 Deposition Author(s): Kursula, I. , Kursula, P. , Lehmann, F. , Song, Y.H. , Wilmanns, M.
0.97-a structure of the sh3 domain of bbc1
Kursula, I. , Kursula, P. , Lehmann, F. , Song, Y.H. , Wilmanns, M.
Primary Citation of Related Structures: 1TG0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myosin tail region-interacting protein MTI1 | A | 68 | Saccharomyces Cerevisiae | MSEPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAVQG |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-05-28 Deposition Author(s): Kursula, I. , Kursula, P. , Lehmann, F. , Song, Y.H. , Wilmanns, M.