Nmr structure of an antagonists of the xiap-caspase-9 interaction complexed to the bir3 domain of xiap
PDB DOI: 10.2210/pdb1tft/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens
Deposited: 2004-05-27 Deposition Author(s): Al-Assaad, A.S. , Armstrong, R.C. , Betz, S.F. , Deckwerth, T.L. , Elmore, S.W. , Fesik, S.W. , Meadows, R.P. , Olejniczak, E.T. , Oleksijew, A.K. , Oltersdorf, T. , Oost, T.K. , Rosenberg, S.H. , Shoemaker, A.R. , Sun, C. , Zou, H.
Nmr structure of an antagonists of the xiap-caspase-9 interaction complexed to the bir3 domain of xiap
Al-Assaad, A.S. , Armstrong, R.C. , Betz, S.F. , Deckwerth, T.L. , Elmore, S.W. , Fesik, S.W. , Meadows, R.P. , Olejniczak, E.T. , Oleksijew, A.K. , Oltersdorf, T. , Oost, T.K. , Rosenberg, S.H. , Shoemaker, A.R. , Sun, C. , Zou, H.
Primary Citation of Related Structures: 1TFT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Baculoviral IAP repeat-containing protein 4 | A | 117 | Homo Sapiens | MSDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT |
Method: SOLUTION NMR
Deposited Date: 2004-05-27 Deposition Author(s): Al-Assaad, A.S. , Armstrong, R.C. , Betz, S.F. , Deckwerth, T.L. , Elmore, S.W. , Fesik, S.W. , Meadows, R.P. , Olejniczak, E.T. , Oleksijew, A.K. , Oltersdorf, T. , Oost, T.K. , Rosenberg, S.H. , Shoemaker, A.R. , Sun, C. , Zou, H.