Crystal structure of the androgen receptor ligand binding domain in complex with a fxxff motif
PDB DOI: 10.2210/pdb1t73/pdb
Classification: HORMONE/GROWTH FACTOR RECEPTOR Organism(s): Pan Troglodytes , Synthetic Construct
Deposited: 2004-05-07 Deposition Author(s): Buehrer, B.M. , Fletterick, R.J. , Gron, H. , Hur, E. , Payne, E.S. , Pfaff, S.J.
Crystal structure of the androgen receptor ligand binding domain in complex with a fxxff motif
Buehrer, B.M. , Fletterick, R.J. , Gron, H. , Hur, E. , Payne, E.S. , Pfaff, S.J.
Primary Citation of Related Structures: 1T73
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Androgen receptor | A | 269 | Pan Troglodytes , Synthetic Construct | GSPGISGGGGGSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ |
| FxxFF motif peptide | B | 20 | Pan Troglodytes , Synthetic Construct | SRFADFFRNEGLGSRSGSGK |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-05-07 Deposition Author(s): Buehrer, B.M. , Fletterick, R.J. , Gron, H. , Hur, E. , Payne, E.S. , Pfaff, S.J.