Structure of the dna binding domains of irf3, atf-2 and jun bound to dna
PDB DOI: 10.2210/pdb1t2k/pdb
Classification: Transcription/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2004-04-21 Deposition Author(s): Harrison, S.C. , Maniatis, T. , Panne, D.
Method: X-RAY DIFFRACTION Resolution: 3 Å
Structure of the dna binding domains of irf3, atf-2 and jun bound to dna
Harrison, S.C. , Maniatis, T. , Panne, D.
Primary Citation of Related Structures: 1T2K
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Interferon regulatory factor 3 | A | 112 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS |
Interferon regulatory factor 3 | B | 112 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS |
Transcription factor AP-1 | C | 62 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKAERKRMRNRIAASKSRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMN |
Cyclic-AMP-dependent transcription factor ATF-2 | D | 61 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLA |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-04-21 Deposition Author(s): Harrison, S.C. , Maniatis, T. , Panne, D.