The solution structure of the pointed (pnt) domain from the transcrition factor erg
PDB DOI: 10.2210/pdb1sxe/pdb
Classification: TRANSCRIPTION, SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2004-03-30 Deposition Author(s): Gentile, L.N. , Macintosh, S.E. , Mackereth, C.D. , Mcintosh, L.P. , Schaerpf, M. , Slupsky, C.M.
The solution structure of the pointed (pnt) domain from the transcrition factor erg
Gentile, L.N. , Macintosh, S.E. , Mackereth, C.D. , Mcintosh, L.P. , Schaerpf, M. , Slupsky, C.M.
Primary Citation of Related Structures: 1SXE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcriptional regulator ERG | A | 97 | Homo Sapiens | GSHMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLP |
Method: SOLUTION NMR
Deposited Date: 2004-03-30 Deposition Author(s): Gentile, L.N. , Macintosh, S.E. , Mackereth, C.D. , Mcintosh, L.P. , Schaerpf, M. , Slupsky, C.M.