1SSL
Solution structure of the psi domain from the met receptor
PDB DOI: 10.2210/pdb1ssl/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2004-03-24 Deposition Author(s): Cygler, M. , Ekiel, I. , Gehring, K. , Kozlov, G. , Perreault, A. , Schrag, J.D.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the psi domain from the met receptor
Cygler, M. , Ekiel, I. , Gehring, K. , Kozlov, G. , Perreault, A. , Schrag, J.D.
Primary Citation of Related Structures: 1SSL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hepatocyte growth factor receptor | A | 48 | Homo Sapiens | GSAMGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICL |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2004-03-24 Deposition Author(s): Cygler, M. , Ekiel, I. , Gehring, K. , Kozlov, G. , Perreault, A. , Schrag, J.D.