Solution structure of the second complement control protein (ccp) module of the gaba(b)r1a receptor, pro-119 cis conformer
PDB DOI: 10.2210/pdb1ss2/pdb
Classification: SIGNALING PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2004-03-23 Deposition Author(s): Barlow, P.N. , Blein, S. , Smith, B.O. , Uhrin, D. , White, J.H.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the second complement control protein (ccp) module of the gaba(b)r1a receptor, pro-119 cis conformer
Barlow, P.N. , Blein, S. , Smith, B.O. , Uhrin, D. , White, J.H.
Primary Citation of Related Structures: 1SS2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gamma-aminobutyric acid type B receptor, subunit 1 | A | 68 | Rattus Norvegicus | EAEFVRICSKSYLTLENGKVFLTGGDLPALDGARVEFRCDPDFHLVGSSRSVCSQGQWSTPKPHCQVN |
Method: SOLUTION NMR
Deposited Date: 2004-03-23 Deposition Author(s): Barlow, P.N. , Blein, S. , Smith, B.O. , Uhrin, D. , White, J.H.