Solution structure of a loop truncated mutant from d. gigas rubredoxin, nmr
PDB DOI: 10.2210/pdb1spw/pdb
Classification: ELECTRON TRANSPORT Organism(s): Desulfovibrio Gigas
Deposited: 2004-03-17 Deposition Author(s): Dos Santos, W. , Lamosa, P. , Legall, J. , Pais, T.M. , Santos, H. , Turner, D.L.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of a loop truncated mutant from d. gigas rubredoxin, nmr
Dos Santos, W. , Lamosa, P. , Legall, J. , Pais, T.M. , Santos, H. , Turner, D.L.
Primary Citation of Related Structures: 1SPW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Rubredoxin | A | 39 | Desulfovibrio Gigas | MDIYVCTVCGYEYDPAFEDLPDDWACPVCGASKDAFEKQ |
Method: SOLUTION NMR
Deposited Date: 2004-03-17 Deposition Author(s): Dos Santos, W. , Lamosa, P. , Legall, J. , Pais, T.M. , Santos, H. , Turner, D.L.