Crystal structure of cp rd l41a mutant in reduced state 1 (drop-reduced)
PDB DOI: 10.2210/pdb1smu/pdb
Classification: ELECTRON TRANSPORT Organism(s): Escherichia Coli (Strain Atcc 8739 / Dsm 1576 / Crooks)
Deposited: 2004-03-09 Deposition Author(s): Eidsness, M.K. , Harley, J.L. , Ichiye, T. , Kang, C. , Park, I.Y. , Smith, E. , Youn, B.
Crystal structure of cp rd l41a mutant in reduced state 1 (drop-reduced)
Eidsness, M.K. , Harley, J.L. , Ichiye, T. , Kang, C. , Park, I.Y. , Smith, E. , Youn, B.
Primary Citation of Related Structures: 1SMU
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Rubredoxin | A | 54 | Escherichia Coli (Strain Atcc 8739 / Dsm 1576 / Crooks) | MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPACGVGKDQFEEVEE |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-03-09 Deposition Author(s): Eidsness, M.K. , Harley, J.L. , Ichiye, T. , Kang, C. , Park, I.Y. , Smith, E. , Youn, B.