Calcium-bound e41a mutant of the n-domain of chicken troponin c, nmr, 40 structures
PDB DOI: 10.2210/pdb1smg/pdb
Classification: CALCIUM-BINDING PROTEIN Organism(s): Gallus Gallus
Deposited: 1997-02-04 Deposition Author(s): Gagne, S.M. , Li, M.X. , Sykes, B.D.
Calcium-bound e41a mutant of the n-domain of chicken troponin c, nmr, 40 structures
Gagne, S.M. , Li, M.X. , Sykes, B.D.
Primary Citation of Related Structures: 1SMG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TROPONIN C | A | 90 | Gallus Gallus | ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKALGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDA |
Method: SOLUTION NMR
Deposited Date: 1997-02-04 Deposition Author(s): Gagne, S.M. , Li, M.X. , Sykes, B.D.