Alternative native flap conformation revealed by 2.3 angstroms resolution structure of siv proteinase
PDB DOI: 10.2210/pdb1sip/pdb
Classification: HYDROLASE(ACID PROTEINASE) Organism(s): Simian Immunodeficiency Virus
Deposited: 1994-04-13 Deposition Author(s): Wilderspin, A.F.
Alternative native flap conformation revealed by 2.3 angstroms resolution structure of siv proteinase
Primary Citation of Related Structures: 1SIP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| UNLIGANDED SIV PROTEASE | A | 99 | Simian Immunodeficiency Virus | PQFSLWRRPVVTAHIEGQPVEVLLDTGADDSIVTGIELGPHYTPKIVGGIGGFINTKEYKNVEIEVLGKRIRGTIMTGDTPINIFGRNLLTALGMSLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 1994-04-13 Deposition Author(s): Wilderspin, A.F.