Crystal structure of a multiple hydrophobic core mutant of ubiquitin
PDB DOI: 10.2210/pdb1sif/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2004-02-29 Deposition Author(s): Benitez-Cardoza, C.G. , Hirshberg, M. , Jackson, S.E. , Stott, K. , Went, H.M. , Woolfson, D.N.
Crystal structure of a multiple hydrophobic core mutant of ubiquitin
Benitez-Cardoza, C.G. , Hirshberg, M. , Jackson, S.E. , Stott, K. , Went, H.M. , Woolfson, D.N.
Primary Citation of Related Structures: 1SIF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ubiquitin | A | 88 | Homo Sapiens | HHHHHHLQGLQLFIKTLTGKTFTVEMEPSDTIENLKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGLD |
Method: X-RAY DIFFRACTION
Deposited Date: 2004-02-29 Deposition Author(s): Benitez-Cardoza, C.G. , Hirshberg, M. , Jackson, S.E. , Stott, K. , Went, H.M. , Woolfson, D.N.