Scorpion toxin (osk1 toxin) with high affinity for small conductance ca(2+)-activated k+ channel in neuroblastoma-x-gluoma ng 108-15 hybrid cells, nmr, 30 structures
PDB DOI: 10.2210/pdb1sco/pdb
Classification: POTASSIUM CHANNEL INHIBITOR Organism(s): Orthochirus Scrobiculosus
Deposited: 1996-04-01 Deposition Author(s): Arseniev, A.S. , Grishin, E.V. , Jaravine, V.A. , Nolde, D.E. , Pluzhnikov, K.A.
Scorpion toxin (osk1 toxin) with high affinity for small conductance ca(2+)-activated k+ channel in neuroblastoma-x-gluoma ng 108-15 hybrid cells, nmr, 30 structures
Arseniev, A.S. , Grishin, E.V. , Jaravine, V.A. , Nolde, D.E. , Pluzhnikov, K.A.
Primary Citation of Related Structures: 1SCO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SCORPION TOXIN OSK1 | A | 38 | Orthochirus Scrobiculosus | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK |
Method: SOLUTION NMR
Deposited Date: 1996-04-01 Deposition Author(s): Arseniev, A.S. , Grishin, E.V. , Jaravine, V.A. , Nolde, D.E. , Pluzhnikov, K.A.