1RQ6
Solution structure of ribosomal protein s17e from methanobacterium thermoautotrophicum, northeast structural genomics consortium target tt802 / ontario center for structural proteomics target mth0803
PDB DOI: 10.2210/pdb1rq6/pdb
Classification: TRANSLATION Organism(s): Methanothermobacter Thermautotrophicus
Deposited: 2003-12-04 Deposition Author(s): Arrowsmith, C.H. , Edward, A. , Huang, Y.J. , Jung, J.W. , Kennedy, M.A. , Lee, W. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Semesi, A. , Wu, B. , Yee, A.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of ribosomal protein s17e from methanobacterium thermoautotrophicum, northeast structural genomics consortium target tt802 / ontario center for structural proteomics target mth0803
Arrowsmith, C.H. , Edward, A. , Huang, Y.J. , Jung, J.W. , Kennedy, M.A. , Lee, W. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Semesi, A. , Wu, B. , Yee, A.
Primary Citation of Related Structures: 1RQ6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 30S ribosomal protein S17e | A | 62 | Methanothermobacter Thermautotrophicus | MGNIRTSFVKRIAKEMIETHPGKFTDDFDTNKKLVEEFSTVSTKHLRNKIAGYITRIISQQK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2003-12-04 Deposition Author(s): Arrowsmith, C.H. , Edward, A. , Huang, Y.J. , Jung, J.W. , Kennedy, M.A. , Lee, W. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Semesi, A. , Wu, B. , Yee, A.