Solution structure of conotoxin mrvib
PDB DOI: 10.2210/pdb1rmk/pdb
Classification: TOXIN Organism(s): Conus Marmoreus
Deposited: 2003-11-28 Deposition Author(s): Adams, D.J. , Craik, D.J. , Daly, N.L. , Ekberg, J.A. , Lewis, R.J. , Thomas, L.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of conotoxin mrvib
Adams, D.J. , Craik, D.J. , Daly, N.L. , Ekberg, J.A. , Lewis, R.J. , Thomas, L.
Primary Citation of Related Structures: 1RMK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mu-O-conotoxin MrVIB | A | 31 | Conus Marmoreus | ACSKKWEYCIVPILGFVYCCPGLICGPFVCV |
Method: SOLUTION NMR
Deposited Date: 2003-11-28 Deposition Author(s): Adams, D.J. , Craik, D.J. , Daly, N.L. , Ekberg, J.A. , Lewis, R.J. , Thomas, L.