1RKL
Nmr structure of yeast oligosaccharyltransferase subunit ost4p
PDB DOI: 10.2210/pdb1rkl/pdb
Classification: TRANSFERASE Organism(s): N.A.
Deposited: 2003-11-21 Deposition Author(s): Lennarz, W.J. , Mohanty, S. , Zubkov, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of yeast oligosaccharyltransferase subunit ost4p
Lennarz, W.J. , Mohanty, S. , Zubkov, S.
Primary Citation of Related Structures: 1RKL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 4 kDa subunit | A | 36 | N.A. | MISDEQLNSLAITFGIVMMTLIVIYHAVDSTMSPKN |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2003-11-21 Deposition Author(s): Lennarz, W.J. , Mohanty, S. , Zubkov, S.