Structure of bacteriophage lambda ci-ntd in complex with sigma-region4 of thermus aquaticus bound to dna
PDB DOI: 10.2210/pdb1rio/pdb
Classification: transcription/DNA Organism(s): Treponema Pallidum , Cutibacterium Acnes Hl110Pa4 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-11-17 Deposition Author(s): Darst, S.A. , Hochschild, A. , Jain, D. , Nickels, B.E. , Sun, L.
Method: X-RAY DIFFRACTION Resolution: 2.3 Å
Structure of bacteriophage lambda ci-ntd in complex with sigma-region4 of thermus aquaticus bound to dna
Darst, S.A. , Hochschild, A. , Jain, D. , Nickels, B.E. , Sun, L.
Primary Citation of Related Structures: 1RIO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
sigma factor SigA | H | 73 | Treponema Pallidum , Cutibacterium Acnes Hl110Pa4 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKYHESRTRKLRDFLE |
Repressor protein CI | A | 98 | Treponema Pallidum , Cutibacterium Acnes Hl110Pa4 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVHHHHHH |
Repressor protein CI | B | 98 | Treponema Pallidum , Cutibacterium Acnes Hl110Pa4 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-11-17 Deposition Author(s): Darst, S.A. , Hochschild, A. , Jain, D. , Nickels, B.E. , Sun, L.