1RGR
Cyclic peptides targeting pdz domains of psd-95: structural basis for enhanced affinity and enzymatic stability
PDB DOI: 10.2210/pdb1rgr/pdb
Classification: STRUCTURAL PROTEIN/DE NOVO PROTEIN Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-11-12 Deposition Author(s): Li, T. , Marshall, J. , Mierke, D.F. , Piserchio, A. , Salinas, G.D. , Spaller, M.R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Cyclic peptides targeting pdz domains of psd-95: structural basis for enhanced affinity and enzymatic stability
Li, T. , Marshall, J. , Mierke, D.F. , Piserchio, A. , Salinas, G.D. , Spaller, M.R.
Primary Citation of Related Structures: 1RGR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Presynaptic density protein 95 | A | 99 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPHHHHHH |
| postsynaptic protein CRIPT peptide | B | 6 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | YKKTEV |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2003-11-12 Deposition Author(s): Li, T. , Marshall, J. , Mierke, D.F. , Piserchio, A. , Salinas, G.D. , Spaller, M.R.