Crystallographic analysis of the interaction of the glucocorticoid receptor with dna
PDB DOI: 10.2210/pdb1r4o/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-10-07 Deposition Author(s): Freedman, L.P. , Luisi, B.F. , Otwinowski, Z. , Sigler, P.B. , Xu, W.X. , Yamamoto, K.R.
Crystallographic analysis of the interaction of the glucocorticoid receptor with dna
Freedman, L.P. , Luisi, B.F. , Otwinowski, Z. , Sigler, P.B. , Xu, W.X. , Yamamoto, K.R.
Primary Citation of Related Structures: 1R4O
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Glucocorticoid receptor | A | 92 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKPARPCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAG |
Glucocorticoid receptor | B | 92 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKPARPCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAG |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-10-07 Deposition Author(s): Freedman, L.P. , Luisi, B.F. , Otwinowski, Z. , Sigler, P.B. , Xu, W.X. , Yamamoto, K.R.