Solution structure of the sendai virus protein x c-subdomain
PDB DOI: 10.2210/pdb1r4g/pdb
Classification: Viral protein, transferase Organism(s): Francisella Philomiragia Subsp. Philomiragia Atcc 25015
Deposited: 2003-10-06 Deposition Author(s): Blackledge, M. , Blanchard, L. , Burmeister, W.P. , Marion, D. , Ruigrok, R.W. , Tarbouriech, N. , Timmins, P.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the sendai virus protein x c-subdomain
Blackledge, M. , Blanchard, L. , Burmeister, W.P. , Marion, D. , Ruigrok, R.W. , Tarbouriech, N. , Timmins, P.
Primary Citation of Related Structures: 1R4G
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RNA polymerase alpha subunit | A | 53 | Francisella Philomiragia Subsp. Philomiragia Atcc 25015 | KPTMHSLRLVIESSPLSRAEKAAYVKSLSKCKTDQEVKAVMELVEEDIESLTN |
Method: SOLUTION NMR
Deposited Date: 2003-10-06 Deposition Author(s): Blackledge, M. , Blanchard, L. , Burmeister, W.P. , Marion, D. , Ruigrok, R.W. , Tarbouriech, N. , Timmins, P.