Thermodynamics of binding of 2-methoxy-3-isopropylpyrazine and 2-methoxy-3-isobutylpyrazine to the major urinary protein
PDB DOI: 10.2210/pdb1qy1/pdb
Classification: TRANSPORT PROTEIN Organism(s): Mus Musculus
Deposited: 2003-09-09 Deposition Author(s): Bingham, R.J. , Bodenhausen, G. , Findlay, J.B.C. , Homans, S.W. , Hsieh, S.-Y. , Kalverda, A.P. , Kjellberg, A. , Perazzolo, C. , Phillips, S.E.V. , Seshadri, K. , Trinh, C.H. , Turnbull, W.B.
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Thermodynamics of binding of 2-methoxy-3-isopropylpyrazine and 2-methoxy-3-isobutylpyrazine to the major urinary protein
Bingham, R.J. , Bodenhausen, G. , Findlay, J.B.C. , Homans, S.W. , Hsieh, S.-Y. , Kalverda, A.P. , Kjellberg, A. , Perazzolo, C. , Phillips, S.E.V. , Seshadri, K. , Trinh, C.H. , Turnbull, W.B.
Primary Citation of Related Structures: 1QY1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Major Urinary Protein | A | 174 | Mus Musculus | MRGSHHHHHHGSEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-09-09 Deposition Author(s): Bingham, R.J. , Bodenhausen, G. , Findlay, J.B.C. , Homans, S.W. , Hsieh, S.-Y. , Kalverda, A.P. , Kjellberg, A. , Perazzolo, C. , Phillips, S.E.V. , Seshadri, K. , Trinh, C.H. , Turnbull, W.B.