Inhibition of hiv-1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion
PDB DOI: 10.2210/pdb1qr9/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus 1
Deposited: 1999-06-18 Deposition Author(s): Burling, F.T. , Ji, H. , Jiang, S.B. , Lu, M. , Shu, W.
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Inhibition of hiv-1 infectivity by the gp41 core: role of a conserved hydrophobic cavity in membrane fusion
Burling, F.T. , Ji, H. , Jiang, S.B. , Lu, M. , Shu, W.
Primary Citation of Related Structures: 1QR9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| GP41 ENVELOPE PROTEIN | A | 68 | Human Immunodeficiency Virus 1 | SGIVQQQNNLLRAIEAQQHLLQATVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-06-18 Deposition Author(s): Burling, F.T. , Ji, H. , Jiang, S.B. , Lu, M. , Shu, W.