The solution structure of the domain from mecp2 that binds to methylated dna
PDB DOI: 10.2210/pdb1qk9/pdb
Classification: METHYL-CPG-BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 1999-07-12 Deposition Author(s): Barlow, P.N. , Bird, A.P. , Free, A. , Nan, X. , Smith, B.O. , Soteriou, A. , Uhrin, D. , Wakefield, R.I.D.
The solution structure of the domain from mecp2 that binds to methylated dna
Barlow, P.N. , Bird, A.P. , Free, A. , Nan, X. , Smith, B.O. , Soteriou, A. , Uhrin, D. , Wakefield, R.I.D.
Primary Citation of Related Structures: 1QK9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| METHYL-CPG-BINDING PROTEIN 2 | A | 92 | Homo Sapiens | ASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSGSGC |
Method: SOLUTION NMR
Deposited Date: 1999-07-12 Deposition Author(s): Barlow, P.N. , Bird, A.P. , Free, A. , Nan, X. , Smith, B.O. , Soteriou, A. , Uhrin, D. , Wakefield, R.I.D.