Solution structure of huwentoxin-i by nmr
PDB DOI: 10.2210/pdb1qk6/pdb
Classification: TOXIN Organism(s): Selenocosmia Huwena
Deposited: 1999-07-10 Deposition Author(s): Ding, J. , Gu, X. , Liang, S. , Liu, X. , Qu, Y. , Zhang, R.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HUWENTOXIN-I | A | 33 | Selenocosmia Huwena | ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL |
Method: SOLUTION NMR